Skip to Content

ELISA Recombinant Putative olfactory receptor GPCRLTM7

https://www.innerear-disorders-therapeutics.com/web/image/product.template/137936/image_1920?unique=a9584cd
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q32VQ0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANLIVVVTVTSDPYLHSSLYILLANLSVIDLTFCSIAARKMICDIFRKQKVISFWGCVA QIFFSHAVGGTEMVLLIAMAFDRYVAVCKPLHYLTIMHPRMCILILVASWAIGLIHSLVQ LSFVVNLPFCGPNVLDSFYCDIPQLIKLACTNTYKLQFMVTANSGFISLSAFFLLILSYI FILATLQKHSSGGSSKAVSTLSAHITVVVLFFGPLIFFYVWPSPPTHLNKFLAIFDAIFT PFLNPVIYTFRNREMKIAIRRVFGQFMGFRKTT Protein Names:Recommended name: Putative olfactory receptor GPCRLTM7 Gene Names: Expression Region:1-273 Sequence Info:fµLl length protein

1,623.00 € 1623.0 EUR 1,623.00 €

1,623.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days